General Information

  • ID:  hor005642
  • Uniprot ID:  P86442
  • Protein name:  Neuropeptide F
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Widely expressed in the nervous system. Expressed in corpora cardiaca, hypocerebral ganglion, frontal ganglion, protocerebrum, antennal lobe, tritocerebrum and thoracic ganglia. Not detected in corpora allata, pars intercerebralis, circumesophageal connec
  • Disease:  NA
  • Comments:  The nonapeptide is a truncated form of the predicted neuropeptide F sequence. The predicted form, which extends from 28-60, is probably processed to a nonapeptide via cleavage at a K-X6-R-Y motif. Initial cleavage by a prohormone convertase presumably occ
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YSQVARPRF
  • Length:  9(52-60)
  • Propeptide:  MSQSRPLALLVVAALVAAAVLVAAAEAQQADGNKLEGLADALKYLQELDRYYSQVARPRFGKRAELRPDVVDDVIPEEMSADKFWRRFARRR
  • Signal peptide:  MSQSRPLALLVVAALVAAAVLVAAAEA
  • Modification:  T9 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Accelerates ovarian maturation in females.
  • Mechanism:  The nonapeptide is a truncated form of the predicted neuropeptide F sequence. The predicted form, which extends from 28-60, is probably processed to a nonapeptide via cleavage at a K-X(6)-R-Y motif. Initial cleavage by a prohormone convertase presumably occurs C-terminally of Arg-50, with the remaining Tyr-51 removed by an aminopeptidase afterwards. The predicted form might be expressed in ovary or midgut.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P86442-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005642_AF2.pdbhor005642_ESM.pdb

Physical Information

Mass: 126614 Formula: C51H78N16O13
Absent amino acids: CDEGHIKLMNTW Common amino acids: R
pI: 11.15 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -82.22 Boman Index: -3009
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 43.33
Instability Index: 3493.33 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  15591108
  • Title:  The Analysis of Large-Scale Gene Expression Correlated to the Phase Changes of the Migratory Locust.
  • PubMed ID:  19456328
  • Title:  Identification of New Members of the (Short) Neuropeptide F Family in Locusts and Caenorhabditis Elegans.